SCOP 1.73: Domain d1xk8b_: 1xk8 B:

Lineage for d1xk8b_ (1xk8 B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)

6. Protein Mammalian CutA-like protein [102975] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117946] (1 PDB entry)

8. Domain d1xk8b_: 1xk8 B: [115403]

Details for d1xk8b_

PDB Entry: 1xk8, 2.7 Å

PDB Description: divalent cation tolerant protein cuta from homo sapiens o60888

PDB Compounds: (B:) Divalent cation tolerant protein CUTA

SCOP Domain Sequences for d1xk8b_:

Sequence; same for both SEQRES and ATOM records:

>d1xk8b_ d.58.5.2 (B:) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte

Timeline for d1xk8b_:

• d1xk8b_ first appeared in SCOP 1.71
  
• d1xk8b_ appears in SCOP 1.75
  
• d1xk8b_ appears in the current release, SCOPe 2.08