SCOPe 2.06: Domain d1xk8a_: 1xk8 A:

Lineage for d1xk8a_ (1xk8 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Mammalian CutA-like protein [102975] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries)
   Uniprot O60888 40-146

8. Domain d1xk8a_: 1xk8 A: [115402]
   Structural genomics target
   complexed with na

Details for d1xk8a_

PDB Entry: 1xk8, 2.7 Å

PDB Description: divalent cation tolerant protein cuta from homo sapiens o60888

PDB Compounds: (A:) Divalent cation tolerant protein CUTA

SCOPe Domain Sequences for d1xk8a_:

Sequence; same for both SEQRES and ATOM records:

>d1xk8a_ d.58.5.2 (A:) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte

Timeline for d1xk8a_:

• d1xk8a_ first appeared in SCOP 1.71
  
• d1xk8a_ appears in SCOPe 2.05
  
• d1xk8a_ appears in SCOPe 2.07
  
• d1xk8a_ appears in the current release, SCOPe 2.08