Lineage for d1xk8a_ (1xk8 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603695Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 603738Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)
  6. 603764Protein Mammalian CutA-like protein [102975] (2 species)
  7. 603765Species Human (Homo sapiens) [TaxId:9606] [117946] (1 PDB entry)
  8. 603766Domain d1xk8a_: 1xk8 A: [115402]

Details for d1xk8a_

PDB Entry: 1xk8 (more details), 2.7 Å

PDB Description: divalent cation tolerant protein cuta from homo sapiens o60888

SCOP Domain Sequences for d1xk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk8a_ d.58.5.2 (A:) Mammalian CutA-like protein {Human (Homo sapiens)}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte

SCOP Domain Coordinates for d1xk8a_:

Click to download the PDB-style file with coordinates for d1xk8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xk8a_: