Lineage for d1xk3a_ (1xk3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732664Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2732665Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
    Uniprot P09601
  8. 2732680Domain d1xk3a_: 1xk3 A: [115400]
    complexed with hem, no; mutant

Details for d1xk3a_

PDB Entry: 1xk3 (more details), 2.08 Å

PDB Description: nadph- and ascorbate-supported heme oxygenase reactions are distinct. regiospecificity of heme cleavage by the r183e mutant
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1xk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk3a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1xk3a_:

Click to download the PDB-style file with coordinates for d1xk3a_.
(The format of our PDB-style files is described here.)

Timeline for d1xk3a_: