SCOPe 2.07: Domain d1xk2b_: 1xk2 B:

Lineage for d1xk2b_ (1xk2 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
   Uniprot P09601

8. Domain d1xk2b_: 1xk2 B: [115399]
   complexed with hem; mutant

Details for d1xk2b_

PDB Entry: 1xk2, 2.2 Å

PDB Description: nadph- and ascorbate-supported heme oxygenase reactions are distinct. regiospecificity of heme cleavage by the r183e mutant

PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1xk2b_:

Sequence; same for both SEQRES and ATOM records:

>d1xk2b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1xk2b_:

• d1xk2b_ first appeared in SCOP 1.71
  
• d1xk2b_ appears in SCOPe 2.06
  
• d1xk2b_ appears in the current release, SCOPe 2.08