SCOP 1.71: Domain d1xk2b_: 1xk2 B:

Lineage for d1xk2b_ (1xk2 B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (14 PDB entries)

8. Domain d1xk2b_: 1xk2 B: [115399]
   complexed with hem; mutant

Details for d1xk2b_

PDB Entry: 1xk2, 2.2 Å

PDB Description: nadph- and ascorbate-supported heme oxygenase reactions are distinct. regiospecificity of heme cleavage by the r183e mutant

SCOP Domain Sequences for d1xk2b_:

Sequence; same for both SEQRES and ATOM records:

>d1xk2b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1xk2b_:

• d1xk2b_ is new in SCOP 1.71
  
• d1xk2b_ appears in SCOP 1.73
  
• d1xk2b_ appears in the current release, SCOPe 2.08