![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Protection of telomeres protein 1, Pot1 [101761] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117190] (1 PDB entry) Uniprot Q9NUX5 6-299 |
![]() | Domain d1xjva2: 1xjv A:149-299 [115397] protein/DNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xjv (more details), 1.73 Å
SCOPe Domain Sequences for d1xjva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xjva2 b.40.4.3 (A:149-299) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]} tllklcdvqpmqyfdltcqllgkaevdgasfllkvwdgtrtpfpswrvliqdlvlegdls hihrlqnltidilvydnhvhvarslkvgsflriyslhtklqsmnsenqtmlslefhlhgg tsygrgirvlpesnsdvdqlkkdlesanlta
Timeline for d1xjva2: