SCOP 1.73: Domain d1xjva1: 1xjv A:6-145

Lineage for d1xjva1 (1xjv A:6-145)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein Protection of telomeres protein 1, Pot1 [101761] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117190] (1 PDB entry)

8. Domain d1xjva1: 1xjv A:6-145 [115396]

Details for d1xjva1

PDB Entry: 1xjv, 1.73 Å

PDB Description: crystal structure of human pot1 bound to telomeric single-stranded dna (ttagggttag)

PDB Compounds: (A:) Protection of telomeres 1

SCOP Domain Sequences for d1xjva1:

Sequence; same for both SEQRES and ATOM records:

>d1xjva1 b.40.4.3 (A:6-145) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]}
atnyiytplnqlkggtivnvygvvkffkppylskgtdycsvvtivdqtnvkltcllfsgn
yealpiiykngdivrfhrlkiqvykketqgitssgfasltfegtlgapiiprtsskyfnf
ttedhkmvealrvwasthms

Timeline for d1xjva1:

• d1xjva1 first appeared in SCOP 1.71
  
• d1xjva1 appears in SCOP 1.75
  
• d1xjva1 appears in the current release, SCOPe 2.08