Lineage for d1xjva1 (1xjv A:6-145)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559752Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 559800Protein Protection of telomeres protein 1, Pot1 [101761] (2 species)
  7. 559810Species Human (Homo sapiens) [TaxId:9606] [117190] (1 PDB entry)
  8. 559811Domain d1xjva1: 1xjv A:6-145 [115396]

Details for d1xjva1

PDB Entry: 1xjv (more details), 1.73 Å

PDB Description: crystal structure of human pot1 bound to telomeric single-stranded dna (ttagggttag)

SCOP Domain Sequences for d1xjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjva1 b.40.4.3 (A:6-145) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens)}
atnyiytplnqlkggtivnvygvvkffkppylskgtdycsvvtivdqtnvkltcllfsgn
yealpiiykngdivrfhrlkiqvykketqgitssgfasltfegtlgapiiprtsskyfnf
ttedhkmvealrvwasthms

SCOP Domain Coordinates for d1xjva1:

Click to download the PDB-style file with coordinates for d1xjva1.
(The format of our PDB-style files is described here.)

Timeline for d1xjva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xjva2