SCOPe 2.08: Domain d1xjva1: 1xjv A:6-145

Lineage for d1xjva1 (1xjv A:6-145)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein Protection of telomeres protein 1, Pot1 [101761] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117190] (1 PDB entry)
   Uniprot Q9NUX5 6-299

8. Domain d1xjva1: 1xjv A:6-145 [115396]
   protein/DNA complex
   has additional insertions and/or extensions that are not grouped together

Details for d1xjva1

PDB Entry: 1xjv, 1.73 Å

PDB Description: crystal structure of human pot1 bound to telomeric single-stranded dna (ttagggttag)

PDB Compounds: (A:) Protection of telomeres 1

SCOPe Domain Sequences for d1xjva1:

Sequence; same for both SEQRES and ATOM records:

>d1xjva1 b.40.4.3 (A:6-145) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]}
atnyiytplnqlkggtivnvygvvkffkppylskgtdycsvvtivdqtnvkltcllfsgn
yealpiiykngdivrfhrlkiqvykketqgitssgfasltfegtlgapiiprtsskyfnf
ttedhkmvealrvwasthms

Timeline for d1xjva1:

• d1xjva1 first appeared in SCOP 1.71
  
• d1xjva1 appears in SCOPe 2.07