SCOPe 2.08: Domain d1xjlb_: 1xjl B:

Lineage for d1xjlb_ (1xjl B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein Annexin II [116947] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116948] (2 PDB entries)
   Uniprot P07355

8. Domain d1xjlb_: 1xjl B: [115391]
   complexed with ca

Details for d1xjlb_

PDB Entry: 1xjl, 2.59 Å

PDB Description: structure of human annexin a2 in the presence of calcium ions

PDB Compounds: (B:) annexin a2

SCOPe Domain Sequences for d1xjlb_:

Sequence; same for both SEQRES and ATOM records:

>d1xjlb_ a.65.1.1 (B:) Annexin II {Human (Homo sapiens) [TaxId: 9606]}
psaygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtk
kelasalksalsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqel
qeinrvykemyktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlyd
agvkrkgtdvpkwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlv
qciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiq
qdtkgdyqkallylcggdd

Timeline for d1xjlb_:

• d1xjlb_ first appeared in SCOP 1.71
  
• d1xjlb_ appears in SCOPe 2.07