Lineage for d1xjla_ (1xjl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000024Protein Annexin II [116947] (2 species)
  7. 2000027Species Human (Homo sapiens) [TaxId:9606] [116948] (2 PDB entries)
    Uniprot P07355
  8. 2000029Domain d1xjla_: 1xjl A: [115390]
    complexed with ca

Details for d1xjla_

PDB Entry: 1xjl (more details), 2.59 Å

PDB Description: Structure of human annexin A2 in the presence of calcium ions
PDB Compounds: (A:) annexin a2

SCOPe Domain Sequences for d1xjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjla_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]}
psaygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtk
kelasalksalsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqel
qeinrvykemyktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlyd
agvkrkgtdvpkwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlv
qciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiq
qdtkgdyqkallylcggdd

SCOPe Domain Coordinates for d1xjla_:

Click to download the PDB-style file with coordinates for d1xjla_.
(The format of our PDB-style files is described here.)

Timeline for d1xjla_: