Lineage for d1xjha_ (1xjh A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038737Fold g.81: HSP33 redox switch-like [118351] (1 superfamily)
    alpha+beta zinc-binding domain; alpha(2)-beta(2)-alpha
  4. 3038738Superfamily g.81.1: HSP33 redox switch-like [118352] (1 family) (S)
  5. 3038739Family g.81.1.1: HSP33 redox switch-like [118353] (1 protein)
  6. 3038740Protein HSP33, C-terminal domain [118354] (3 species)
  7. 3038744Species Escherichia coli [TaxId:562] [118355] (1 PDB entry)
    Uniprot P45803 225-285
  8. 3038745Domain d1xjha_: 1xjh A: [115389]
    complexed with zn

Details for d1xjha_

PDB Entry: 1xjh (more details)

PDB Description: nmr structure of the redox switch domain of the e. coli hsp33
PDB Compounds: (A:) 33 kda chaperonin

SCOPe Domain Sequences for d1xjha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjha_ g.81.1.1 (A:) HSP33, C-terminal domain {Escherichia coli [TaxId: 562]}
mdvefkctcsrercadalktlpdeevdsilaedgeidmhcdycgnhylfnamdiaeirnn
as

SCOPe Domain Coordinates for d1xjha_:

Click to download the PDB-style file with coordinates for d1xjha_.
(The format of our PDB-style files is described here.)

Timeline for d1xjha_: