Lineage for d1xjda_ (1xjd A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735373Protein Protein kinase C, theta type [118129] (1 species)
    AGC group; PKC subfamily; serine/threonine kinase
  7. 735374Species Human (Homo sapiens) [TaxId:9606] [118130] (1 PDB entry)
  8. 735375Domain d1xjda_: 1xjd A: [115388]
    complexed with sto

Details for d1xjda_

PDB Entry: 1xjd (more details), 2 Å

PDB Description: Crystal Structure of PKC-theta complexed with Staurosporine at 2A resolution
PDB Compounds: (A:) Protein kinase C, theta type

SCOP Domain Sequences for d1xjda_:

Sequence, based on SEQRES records: (download)

>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]}
iedfilhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlslaw
ehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqflh
skgivyrdlkldnilldkdghikiadfgmckenmlgdaktntfcgtpdyiapeillgqky
nhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklfvr
epekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfdcsnfdkeflnekprls
fadralinsmdqnmfrnfsf

Sequence, based on observed residues (ATOM records): (download)

>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]}
iedfilhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlslaw
ehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqflh
skgivyrdlkldnilldkdghikiadfgmckenmlgdaktntfcgtpdyiapeillgqky
nhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklfvr
epekrlgvrgdirqhplfreinweelerkeidpqnmfrnfsf

SCOP Domain Coordinates for d1xjda_:

Click to download the PDB-style file with coordinates for d1xjda_.
(The format of our PDB-style files is described here.)

Timeline for d1xjda_: