Lineage for d1xjda_ (1xjd A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544567Protein Protein kinase C, theta type [118129] (1 species)
    AGC group; PKC subfamily; serine/threonine kinase
  7. 2544568Species Human (Homo sapiens) [TaxId:9606] [118130] (1 PDB entry)
    Uniprot Q04759 377-696
  8. 2544569Domain d1xjda_: 1xjd A: [115388]
    complexed with stu

Details for d1xjda_

PDB Entry: 1xjd (more details), 2 Å

PDB Description: Crystal Structure of PKC-theta complexed with Staurosporine at 2A resolution
PDB Compounds: (A:) Protein kinase C, theta type

SCOPe Domain Sequences for d1xjda_:

Sequence, based on SEQRES records: (download)

>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]}
iedfilhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlslaw
ehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqflh
skgivyrdlkldnilldkdghikiadfgmckenmlgdaktntfcgtpdyiapeillgqky
nhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklfvr
epekrlgvrgdirqhplfreinweelerkeidppfrpkvkspfdcsnfdkeflnekprls
fadralinsmdqnmfrnfsf

Sequence, based on observed residues (ATOM records): (download)

>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]}
iedfilhkmlgkgsfgkvflaefkktnqffaikalkkdvvlmdddvectmvekrvlslaw
ehpflthmfctfqtkenlffvmeylnggdlmyhiqschkfdlsratfyaaeiilglqflh
skgivyrdlkldnilldkdghikiadfgmckenmlgdaktntfcgtpdyiapeillgqky
nhsvdwwsfgvllyemligqspfhgqdeeelfhsirmdnpfyprwlekeakdllvklfvr
epekrlgvrgdirqhplfreinweelerkeidpqnmfrnfsf

SCOPe Domain Coordinates for d1xjda_:

Click to download the PDB-style file with coordinates for d1xjda_.
(The format of our PDB-style files is described here.)

Timeline for d1xjda_: