SCOP 1.73: Domain d1xjca_: 1xjc A:

Lineage for d1xjca_ (1xjc A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Molybdopterin-guanine dinucleotide biosynthesis protein MobB [89673] (2 species)
   forms segment-swapped dimer

7. Species Bacillus stearothermophilus [TaxId:1422] [117539] (1 PDB entry)

8. Domain d1xjca_: 1xjc A: [115387]

Details for d1xjca_

PDB Entry: 1xjc, 2.1 Å

PDB Description: X-ray crystal structure of MobB protein homolog from Bacillus stearothermophilus

PDB Compounds: (A:) MobB protein homolog

SCOP Domain Sequences for d1xjca_:

Sequence, based on SEQRES records:

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}
mnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhghggeparpegvdsvrheraga
vatavegdgllqlhlrrplwrlddvlalyaplrldlvlvegykqerhpkvvlvrseedwa
slqhlaniraviaweplegplahpvfsladddeyipwlmnevrtr

Sequence, based on observed residues (ATOM records):

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}
mnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhgavatavegdgllqlhlrrplw
rlddvlalyaplrldlvlvegykqerhpkvvlvrseedwaslqhlaniraviaweplegp
lahpvfsladddeyipwlmnevrtr

Timeline for d1xjca_:

• d1xjca_ first appeared in SCOP 1.71
  
• d1xjca_ appears in SCOP 1.75
  
• d1xjca_ appears in the current release, SCOPe 2.08