Lineage for d1xjac_ (1xja C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2817052Superfamily b.82.4: Regulatory protein AraC [51215] (1 family) (S)
    automatically mapped to Pfam PF02311
  5. 2817053Family b.82.4.1: Regulatory protein AraC [51216] (1 protein)
  6. 2817054Protein Regulatory protein AraC [51217] (1 species)
    contains an alpha-hairpin in the C-terminal extension
  7. 2817055Species Escherichia coli [TaxId:562] [51218] (4 PDB entries)
    Uniprot P03021
  8. 2817062Domain d1xjac_: 1xja C: [115384]
    complexed with edo; mutant

Details for d1xjac_

PDB Entry: 1xja (more details), 2.4 Å

PDB Description: apo form of the y31v mutant dimerization domain fragment of escherichia coli regulatory protein arac
PDB Compounds: (C:) arabinose operon regulatory protein

SCOPe Domain Sequences for d1xjac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjac_ b.82.4.1 (C:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}
dpllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvc
rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
qphfsdlfgqiinagqgegrysellainlleqlllrrmeaineslhppm

SCOPe Domain Coordinates for d1xjac_:

Click to download the PDB-style file with coordinates for d1xjac_.
(The format of our PDB-style files is described here.)

Timeline for d1xjac_: