SCOP 1.73: Domain d1xjaa_: 1xja A:

Lineage for d1xjaa_ (1xja A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.4: Regulatory protein AraC [51215] (1 family)

5. Family b.82.4.1: Regulatory protein AraC [51216] (1 protein)

6. Protein Regulatory protein AraC [51217] (1 species)
   contains an alpha-hairpin in the C-terminal extension

7. Species Escherichia coli [TaxId:562] [51218] (4 PDB entries)

8. Domain d1xjaa_: 1xja A: [115382]

Details for d1xjaa_

PDB Entry: 1xja, 2.4 Å

PDB Description: apo form of the y31v mutant dimerization domain fragment of escherichia coli regulatory protein arac

PDB Compounds: (A:) arabinose operon regulatory protein

SCOP Domain Sequences for d1xjaa_:

Sequence; same for both SEQRES and ATOM records:

>d1xjaa_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}
pllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvcr
pgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahq
phfsdlfgqiinagqgegrysellainlleqlllrrmeaineslh

Timeline for d1xjaa_:

• d1xjaa_ first appeared in SCOP 1.71
  
• d1xjaa_ appears in SCOP 1.75
  
• d1xjaa_ appears in the current release, SCOPe 2.08