Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.4: Regulatory protein AraC [51215] (1 family) automatically mapped to Pfam PF02311 |
Family b.82.4.1: Regulatory protein AraC [51216] (1 protein) |
Protein Regulatory protein AraC [51217] (1 species) contains an alpha-hairpin in the C-terminal extension |
Species Escherichia coli [TaxId:562] [51218] (4 PDB entries) Uniprot P03021 |
Domain d1xjaa_: 1xja A: [115382] complexed with edo; mutant |
PDB Entry: 1xja (more details), 2.4 Å
SCOPe Domain Sequences for d1xjaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xjaa_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} pllpgysfnahlvagltpieangvldffidrplgmkgyilnltirgqgvvknqgrefvcr pgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahq phfsdlfgqiinagqgegrysellainlleqlllrrmeaineslh
Timeline for d1xjaa_:
View in 3D Domains from other chains: (mouse over for more information) d1xjab_, d1xjac_, d1xjad_, d1xjae_ |