SCOPe 2.05: Domain d1xj5a_: 1xj5 A:

Lineage for d1xj5a_ (1xj5 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
   contains additional N-terminal tetramerisation all-beta domain, res. 1-71

6. Protein Spermidine synthase [69558] (6 species)
   polyamine aminopropyltransferase

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117680] (2 PDB entries)
   Uniprot Q9ZUB3

8. Domain d1xj5a_: 1xj5 A: [115378]

Details for d1xj5a_

PDB Entry: 1xj5, 2.7 Å

PDB Description: x-ray structure of spermidine synthase from arabidopsis thaliana gene at1g23820

PDB Compounds: (A:) Spermidine synthase 1

SCOPe Domain Sequences for d1xj5a_:

Sequence; same for both SEQRES and ATOM records:

>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte
rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs
kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs
varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc
stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie

Timeline for d1xj5a_:

• d1xj5a_ first appeared in SCOP 1.71
  
• d1xj5a_ appears in SCOPe 2.04
  
• d1xj5a_ appears in SCOPe 2.06
  
• d1xj5a_ appears in the current release, SCOPe 2.08