Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) |
Family c.66.1.17: Spermidine synthase [69557] (2 proteins) contains additional N-terminal tetramerisation all-beta domain, res. 1-71 |
Protein Spermidine synthase [69558] (4 species) polyamine aminopropyltransferase |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117680] (1 PDB entry) |
Domain d1xj5a_: 1xj5 A: [115378] |
PDB Entry: 1xj5 (more details), 2.7 Å
SCOP Domain Sequences for d1xj5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana)} stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie
Timeline for d1xj5a_: