Lineage for d1xj1a_ (1xj1 A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459352Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 1459495Family g.3.6.5: Vhv1.1, polydnaviral gene product [118237] (1 protein)
    automatically mapped to Pfam PF08008
  6. 1459496Protein Vhv1.1, polydnaviral gene product [118238] (1 species)
  7. 1459497Species Campoletis sonorensis virus, CsIV [TaxId:10484] [118239] (2 PDB entries)
    Uniprot Q89632 162-208
  8. 1459499Domain d1xj1a_: 1xj1 A: [115377]

Details for d1xj1a_

PDB Entry: 1xj1 (more details)

PDB Description: 3D solution structure of the C-terminal cysteine-rich domain of the VHv1.1 polydnaviral gene product
PDB Compounds: (A:) cysteine-rich omega-conotoxin homolog VHv1.1

SCOPe Domain Sequences for d1xj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xj1a_ g.3.6.5 (A:) Vhv1.1, polydnaviral gene product {Campoletis sonorensis virus, CsIV [TaxId: 10484]}
tcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdg

SCOPe Domain Coordinates for d1xj1a_:

Click to download the PDB-style file with coordinates for d1xj1a_.
(The format of our PDB-style files is described here.)

Timeline for d1xj1a_: