SCOP 1.75: Domain d1xizb_: 1xiz B:

Lineage for d1xizb_ (1xiz B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
   beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing

4. Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (2 families)

5. Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (3 proteins)

6. Protein Putative PTS protein STM3784 [118081] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [118082] (1 PDB entry)
   Uniprot Q8ZL18

8. Domain d1xizb_: 1xiz B: [115376]
   Structural genomics target

Details for d1xizb_

PDB Entry: 1xiz, 2 Å

PDB Description: Structural Genomics, The crystal structure of domain IIA of putative phosphotransferase system specific for mannitol/fructose from Salmonella typhimurium

PDB Compounds: (B:) putative phosphotransferase system mannitol/fructose-specific IIA domain

SCOP Domain Sequences for d1xizb_:

Sequence; same for both SEQRES and ATOM records:

>d1xizb_ d.112.1.1 (B:) Putative PTS protein STM3784 {Salmonella typhimurium [TaxId: 90371]}
amqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpve
pvgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnvl
gwimdviqdedfmqqllvmnddeiyqsiytriserg

Timeline for d1xizb_:

• d1xizb_ first appeared in SCOP 1.71
  
• d1xizb_ appears in SCOP 1.73
  
• d1xizb_ appears in SCOPe 2.01
  
• d1xizb_ appears in the current release, SCOPe 2.08, called d1xizb1