Lineage for d1xizb_ (1xiz B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731904Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 731905Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (2 families) (S)
  5. 731906Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (3 proteins)
  6. 731918Protein Putative PTS protein STM3784 [118081] (1 species)
  7. 731919Species Salmonella typhimurium [TaxId:90371] [118082] (1 PDB entry)
  8. 731921Domain d1xizb_: 1xiz B: [115376]
    Structural genomics target

Details for d1xizb_

PDB Entry: 1xiz (more details), 2 Å

PDB Description: Structural Genomics, The crystal structure of domain IIA of putative phosphotransferase system specific for mannitol/fructose from Salmonella typhimurium
PDB Compounds: (B:) putative phosphotransferase system mannitol/fructose-specific IIA domain

SCOP Domain Sequences for d1xizb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xizb_ d.112.1.1 (B:) Putative PTS protein STM3784 {Salmonella typhimurium [TaxId: 602]}
amqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpve
pvgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnvl
gwimdviqdedfmqqllvmnddeiyqsiytriserg

SCOP Domain Coordinates for d1xizb_:

Click to download the PDB-style file with coordinates for d1xizb_.
(The format of our PDB-style files is described here.)

Timeline for d1xizb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xiza_