![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing |
![]() | Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) ![]() |
![]() | Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins) automatically mapped to Pfam PF00359 |
![]() | Protein Putative PTS protein STM3784 [118081] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [118082] (1 PDB entry) Uniprot Q8ZL18 |
![]() | Domain d1xizb1: 1xiz B:1-155 [115376] Other proteins in same PDB: d1xiza2, d1xizb2 Structural genomics target |
PDB Entry: 1xiz (more details), 2 Å
SCOPe Domain Sequences for d1xizb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xizb1 d.112.1.1 (B:1-155) Putative PTS protein STM3784 {Salmonella typhimurium [TaxId: 90371]} mqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpvep vgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnvlg wimdviqdedfmqqllvmnddeiyqsiytriserg
Timeline for d1xizb1: