Lineage for d1xizb1 (1xiz B:1-155)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971248Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 2971249Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 2971250Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
    automatically mapped to Pfam PF00359
  6. 2971263Protein Putative PTS protein STM3784 [118081] (1 species)
  7. 2971264Species Salmonella typhimurium [TaxId:90371] [118082] (1 PDB entry)
    Uniprot Q8ZL18
  8. 2971266Domain d1xizb1: 1xiz B:1-155 [115376]
    Other proteins in same PDB: d1xiza2, d1xizb2
    Structural genomics target

Details for d1xizb1

PDB Entry: 1xiz (more details), 2 Å

PDB Description: Structural Genomics, The crystal structure of domain IIA of putative phosphotransferase system specific for mannitol/fructose from Salmonella typhimurium
PDB Compounds: (B:) putative phosphotransferase system mannitol/fructose-specific IIA domain

SCOPe Domain Sequences for d1xizb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xizb1 d.112.1.1 (B:1-155) Putative PTS protein STM3784 {Salmonella typhimurium [TaxId: 90371]}
mqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpvep
vgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnvlg
wimdviqdedfmqqllvmnddeiyqsiytriserg

SCOPe Domain Coordinates for d1xizb1:

Click to download the PDB-style file with coordinates for d1xizb1.
(The format of our PDB-style files is described here.)

Timeline for d1xizb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xizb2