SCOPe 2.08: Domain d1xizb1: 1xiz B:1-155

Lineage for d1xizb1 (1xiz B:1-155)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
   beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing

4. Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families)

5. Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
   automatically mapped to Pfam PF00359

6. Protein Putative PTS protein STM3784 [118081] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [118082] (1 PDB entry)
   Uniprot Q8ZL18

8. Domain d1xizb1: 1xiz B:1-155 [115376]
   Other proteins in same PDB: d1xiza2, d1xizb2
   Structural genomics target

Details for d1xizb1

PDB Entry: 1xiz, 2 Å

PDB Description: Structural Genomics, The crystal structure of domain IIA of putative phosphotransferase system specific for mannitol/fructose from Salmonella typhimurium

PDB Compounds: (B:) putative phosphotransferase system mannitol/fructose-specific IIA domain

SCOPe Domain Sequences for d1xizb1:

Sequence; same for both SEQRES and ATOM records:

>d1xizb1 d.112.1.1 (B:1-155) Putative PTS protein STM3784 {Salmonella typhimurium [TaxId: 90371]}
mqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpvep
vgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnvlg
wimdviqdedfmqqllvmnddeiyqsiytriserg

Timeline for d1xizb1:

• d1xizb1 first appeared in SCOP 1.71, called d1xizb_
  
• d1xizb1 appears in SCOPe 2.07