![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing |
![]() | Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (2 families) ![]() |
![]() | Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (3 proteins) |
![]() | Protein Putative PTS protein STM3784 [118081] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [118082] (1 PDB entry) |
![]() | Domain d1xiza_: 1xiz A: [115375] |
PDB Entry: 1xiz (more details), 2 Å
SCOP Domain Sequences for d1xiza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xiza_ d.112.1.1 (A:) Putative PTS protein STM3784 {Salmonella typhimurium [TaxId: 602]} namqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv epvgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnv lgwimdviqdedfmqqllvmnddeiyqsiytrise
Timeline for d1xiza_: