Lineage for d1xiza_ (1xiz A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609699Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 609700Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (2 families) (S)
  5. 609701Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (3 proteins)
  6. 609713Protein Putative PTS protein STM3784 [118081] (1 species)
  7. 609714Species Salmonella typhimurium [TaxId:90371] [118082] (1 PDB entry)
  8. 609715Domain d1xiza_: 1xiz A: [115375]

Details for d1xiza_

PDB Entry: 1xiz (more details), 2 Å

PDB Description: Structural Genomics, The crystal structure of domain IIA of putative phosphotransferase system specific for mannitol/fructose from Salmonella typhimurium

SCOP Domain Sequences for d1xiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiza_ d.112.1.1 (A:) Putative PTS protein STM3784 {Salmonella typhimurium}
namqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv
epvgvaiphtdhkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnv
lgwimdviqdedfmqqllvmnddeiyqsiytrise

SCOP Domain Coordinates for d1xiza_:

Click to download the PDB-style file with coordinates for d1xiza_.
(The format of our PDB-style files is described here.)

Timeline for d1xiza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xizb_