SCOP 1.73: Domain d1xiwh_: 1xiw H:

Lineage for d1xiwh_ (1xiw H:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1xiwh_: 1xiw H: [115374]
   Other proteins in same PDB: d1xiwa_, d1xiwb_, d1xiwc_, d1xiwe_, d1xiwf_, d1xiwg_

Details for d1xiwh_

PDB Entry: 1xiw, 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment

PDB Compounds: (H:) immunoglobulin heavy chain variable region

SCOP Domain Sequences for d1xiwh_:

Sequence; same for both SEQRES and ATOM records:

>d1xiwh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgpelvkpgasmkisckasgysftgytmnwvkqshgknlewmglinpykgvsty
nqkfkdkatltvdkssstaymellsltsedsavyycarsgyygdsdwyfdvwgqgttltv
fs

Timeline for d1xiwh_:

• d1xiwh_ first appeared in SCOP 1.71
  
• d1xiwh_ appears in SCOP 1.75
  
• d1xiwh_ appears in the current release, SCOPe 2.08