Lineage for d1xiwg_ (1xiw G:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653557Domain d1xiwg_: 1xiw G: [115373]
    Other proteins in same PDB: d1xiwa_, d1xiwb_, d1xiwd_, d1xiwe_, d1xiwf_, d1xiwh_

Details for d1xiwg_

PDB Entry: 1xiw (more details), 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment
PDB Compounds: (G:) immunoglobulin light chain variable region

SCOP Domain Sequences for d1xiwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiwg_ b.1.1.1 (G:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
mdiqmtqttsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlhsgvp
skfsgsgsgtdysltisnleqediatyfcqqgntlpwtfaggtklei

SCOP Domain Coordinates for d1xiwg_:

Click to download the PDB-style file with coordinates for d1xiwg_.
(The format of our PDB-style files is described here.)

Timeline for d1xiwg_: