SCOP 1.71: Domain d1xiwg_: 1xiw G:

Lineage for d1xiwg_ (1xiw G:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1xiwg_: 1xiw G: [115373]
   Other proteins in same PDB: d1xiwa_, d1xiwb_, d1xiwd_, d1xiwe_, d1xiwf_, d1xiwh_

Details for d1xiwg_

PDB Entry: 1xiw, 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment

SCOP Domain Sequences for d1xiwg_:

Sequence; same for both SEQRES and ATOM records:

>d1xiwg_ b.1.1.1 (G:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
mdiqmtqttsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlhsgvp
skfsgsgsgtdysltisnleqediatyfcqqgntlpwtfaggtklei

Timeline for d1xiwg_:

• d1xiwg_ is new in SCOP 1.71
  
• d1xiwg_ appears in SCOP 1.73
  
• d1xiwg_ appears in the current release, SCOPe 2.08