SCOP 1.75: Domain d1xiwf_: 1xiw F:

Lineage for d1xiwf_ (1xiw F:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (38 proteins)

6. Protein CD3 delta chain ectodomain fragment [117043] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117044] (1 PDB entry)
   Uniprot P04234 23-95

8. Domain d1xiwf_: 1xiw F: [115372]
   Other proteins in same PDB: d1xiwa_, d1xiwc_, d1xiwd_, d1xiwe_, d1xiwg_, d1xiwh_

Details for d1xiwf_

PDB Entry: 1xiw, 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment

PDB Compounds: (F:) T-cell surface glycoprotein CD3 delta chain

SCOP Domain Sequences for d1xiwf_:

Sequence, based on SEQRES records:

>d1xiwf_ b.1.1.4 (F:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
kipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykdk
estvqvhyrmc

Sequence, based on observed residues (ATOM records):

>d1xiwf_ b.1.1.4 (F:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
kipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvhy
rmc

Timeline for d1xiwf_:

• d1xiwf_ first appeared in SCOP 1.71
  
• d1xiwf_ appears in SCOP 1.73
  
• d1xiwf_ appears in SCOPe 2.01
  
• d1xiwf_ appears in the current release, SCOPe 2.08