Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (36 proteins) |
Protein CD3 delta chain ectodomain fragment [117043] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117044] (1 PDB entry) |
Domain d1xiwf_: 1xiw F: [115372] Other proteins in same PDB: d1xiwa_, d1xiwc_, d1xiwd_, d1xiwe_, d1xiwg_, d1xiwh_ |
PDB Entry: 1xiw (more details), 1.9 Å
SCOP Domain Sequences for d1xiwf_:
Sequence, based on SEQRES records: (download)
>d1xiwf_ b.1.1.4 (F:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} kipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykdk estvqvhyrmc
>d1xiwf_ b.1.1.4 (F:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} kipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvhy rmc
Timeline for d1xiwf_: