SCOPe 2.06: Domain d1xiwd_: 1xiw D:

Lineage for d1xiwd_ (1xiw D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1xiwd_: 1xiw D: [115370]
   Other proteins in same PDB: d1xiwa_, d1xiwb_, d1xiwc_, d1xiwe_, d1xiwf_, d1xiwg_

Details for d1xiwd_

PDB Entry: 1xiw, 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment

PDB Compounds: (D:) immunoglobulin heavy chain variable region

SCOPe Domain Sequences for d1xiwd_:

Sequence; same for both SEQRES and ATOM records:

>d1xiwd_ b.1.1.1 (D:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgpelvkpgasmkisckasgysftgytmnwvkqshgknlewmglinpykgvsty
nqkfkdkatltvdkssstaymellsltsedsavyycarsgyygdsdwyfdvwgqgttltv
fs

Timeline for d1xiwd_:

• d1xiwd_ first appeared in SCOP 1.71
  
• d1xiwd_ appears in SCOPe 2.05
  
• d1xiwd_ appears in SCOPe 2.07
  
• d1xiwd_ appears in the current release, SCOPe 2.08