Lineage for d1xiwd_ (1xiw D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546882Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 546904Domain d1xiwd_: 1xiw D: [115370]
    Other proteins in same PDB: d1xiwa_, d1xiwb_, d1xiwc_, d1xiwe_, d1xiwf_, d1xiwg_

Details for d1xiwd_

PDB Entry: 1xiw (more details), 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment
PDB Compounds: (D:)

SCOP Domain Sequences for d1xiwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiwd_ b.1.1.1 (D:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgpelvkpgasmkisckasgysftgytmnwvkqshgknlewmglinpykgvsty
nqkfkdkatltvdkssstaymellsltsedsavyycarsgyygdsdwyfdvwgqgttltv
fs

SCOP Domain Coordinates for d1xiwd_:

Click to download the PDB-style file with coordinates for d1xiwd_.
(The format of our PDB-style files is described here.)

Timeline for d1xiwd_: