SCOPe 2.05: Domain d1xiwb_: 1xiw B:

Lineage for d1xiwb_ (1xiw B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein CD3 delta chain ectodomain fragment [117043] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117044] (1 PDB entry)
   Uniprot P04234 23-95

8. Domain d1xiwb_: 1xiw B: [115368]
   Other proteins in same PDB: d1xiwa_, d1xiwc_, d1xiwd_, d1xiwe_, d1xiwg_, d1xiwh_

Details for d1xiwb_

PDB Entry: 1xiw, 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment

PDB Compounds: (B:) T-cell surface glycoprotein CD3 delta chain

SCOPe Domain Sequences for d1xiwb_:

Sequence, based on SEQRES records:

>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykd
kestvqvhyrmcqs

Sequence, based on observed residues (ATOM records):

>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvh
yrmcqs

Timeline for d1xiwb_:

• d1xiwb_ first appeared in SCOP 1.71
  
• d1xiwb_ appears in SCOPe 2.04
  
• d1xiwb_ appears in SCOPe 2.06
  
• d1xiwb_ appears in the current release, SCOPe 2.08