Lineage for d1xiwb_ (1xiw B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 656856Protein CD3 delta chain ectodomain fragment [117043] (1 species)
  7. 656857Species Human (Homo sapiens) [TaxId:9606] [117044] (1 PDB entry)
  8. 656858Domain d1xiwb_: 1xiw B: [115368]
    Other proteins in same PDB: d1xiwa_, d1xiwc_, d1xiwd_, d1xiwe_, d1xiwg_, d1xiwh_

Details for d1xiwb_

PDB Entry: 1xiw (more details), 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment
PDB Compounds: (B:) T-cell surface glycoprotein CD3 delta chain

SCOP Domain Sequences for d1xiwb_:

Sequence, based on SEQRES records: (download)

>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykd
kestvqvhyrmcqs

Sequence, based on observed residues (ATOM records): (download)

>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvh
yrmcqs

SCOP Domain Coordinates for d1xiwb_:

Click to download the PDB-style file with coordinates for d1xiwb_.
(The format of our PDB-style files is described here.)

Timeline for d1xiwb_: