![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein CD3 delta chain ectodomain fragment [117043] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117044] (1 PDB entry) Uniprot P04234 23-95 |
![]() | Domain d1xiwb_: 1xiw B: [115368] Other proteins in same PDB: d1xiwa_, d1xiwc_, d1xiwd_, d1xiwe_, d1xiwg_, d1xiwh_ |
PDB Entry: 1xiw (more details), 1.9 Å
SCOPe Domain Sequences for d1xiwb_:
Sequence, based on SEQRES records: (download)
>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykd kestvqvhyrmcqs
>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvh yrmcqs
Timeline for d1xiwb_: