Lineage for d1xiwb_ (1xiw B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026186Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2026206Protein CD3 delta chain ectodomain fragment [117043] (1 species)
  7. 2026207Species Human (Homo sapiens) [TaxId:9606] [117044] (1 PDB entry)
    Uniprot P04234 23-95
  8. 2026208Domain d1xiwb_: 1xiw B: [115368]
    Other proteins in same PDB: d1xiwa_, d1xiwc_, d1xiwd_, d1xiwe_, d1xiwg_, d1xiwh_

Details for d1xiwb_

PDB Entry: 1xiw (more details), 1.9 Å

PDB Description: Crystal structure of human CD3-e/d dimer in complex with a UCHT1 single-chain antibody fragment
PDB Compounds: (B:) T-cell surface glycoprotein CD3 delta chain

SCOPe Domain Sequences for d1xiwb_:

Sequence, based on SEQRES records: (download)

>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykd
kestvqvhyrmcqs

Sequence, based on observed residues (ATOM records): (download)

>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
mkipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvh
yrmcqs

SCOPe Domain Coordinates for d1xiwb_:

Click to download the PDB-style file with coordinates for d1xiwb_.
(The format of our PDB-style files is described here.)

Timeline for d1xiwb_: