SCOPe 2.06: Domain d1xiwa_: 1xiw A:

Lineage for d1xiwa_ (1xiw A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [110051] (2 PDB entries)
   Uniprot P07766 33-123 ! Uniprot P07766 # CD3E_HUMAN T-cell surface glycoprotein CD3 epsilon chain precursor

8. Domain d1xiwa_: 1xiw A: [115367]
   Other proteins in same PDB: d1xiwb_, d1xiwc_, d1xiwd_, d1xiwf_, d1xiwg_, d1xiwh_

Details for d1xiwa_

PDB Entry: 1xiw, 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment

PDB Compounds: (A:) T-cell surface glycoprotein CD3 epsilon chain

SCOPe Domain Sequences for d1xiwa_:

Sequence; same for both SEQRES and ATOM records:

>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
qtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleq
sgyyvcyprgskpedanfylylrarvcencm

Timeline for d1xiwa_:

• d1xiwa_ first appeared in SCOP 1.71
  
• d1xiwa_ appears in SCOPe 2.05
  
• d1xiwa_ appears in SCOPe 2.07
  
• d1xiwa_ appears in the current release, SCOPe 2.08