Lineage for d1xiwa_ (1xiw A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 550483Family b.1.1.4: I set domains [49159] (34 proteins)
  6. 550504Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 550505Species Human (Homo sapiens) [TaxId:9606] [110051] (2 PDB entries)
  8. 550506Domain d1xiwa_: 1xiw A: [115367]
    Other proteins in same PDB: d1xiwb_, d1xiwc_, d1xiwd_, d1xiwf_, d1xiwg_, d1xiwh_

Details for d1xiwa_

PDB Entry: 1xiw (more details), 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment

SCOP Domain Sequences for d1xiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens)}
qtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleq
sgyyvcyprgskpedanfylylrarvcencm

SCOP Domain Coordinates for d1xiwa_:

Click to download the PDB-style file with coordinates for d1xiwa_.
(The format of our PDB-style files is described here.)

Timeline for d1xiwa_: