Lineage for d1xiwa_ (1xiw A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026186Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2026210Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2026211Species Human (Homo sapiens) [TaxId:9606] [110051] (2 PDB entries)
    Uniprot P07766 33-123 ! Uniprot P07766 # CD3E_HUMAN T-cell surface glycoprotein CD3 epsilon chain precursor
  8. 2026212Domain d1xiwa_: 1xiw A: [115367]
    Other proteins in same PDB: d1xiwb_, d1xiwc_, d1xiwd_, d1xiwf_, d1xiwg_, d1xiwh_

Details for d1xiwa_

PDB Entry: 1xiw (more details), 1.9 Å

PDB Description: Crystal structure of human CD3-e/d dimer in complex with a UCHT1 single-chain antibody fragment
PDB Compounds: (A:) T-cell surface glycoprotein CD3 epsilon chain

SCOPe Domain Sequences for d1xiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
qtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleq
sgyyvcyprgskpedanfylylrarvcencm

SCOPe Domain Coordinates for d1xiwa_:

Click to download the PDB-style file with coordinates for d1xiwa_.
(The format of our PDB-style files is described here.)

Timeline for d1xiwa_: