Lineage for d1xiqf_ (1xiq F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724253Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117947] (1 PDB entry)
  8. 724259Domain d1xiqf_: 1xiq F: [115366]

Details for d1xiqf_

PDB Entry: 1xiq (more details), 3.05 Å

PDB Description: plasmodium falciparum nucleoside diphosphate kinase b
PDB Compounds: (F:) Nucleoside diphosphate kinase B

SCOP Domain Sequences for d1xiqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiqf_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}
meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
asankeiniwfkaeeltqwkhhmkewics

SCOP Domain Coordinates for d1xiqf_:

Click to download the PDB-style file with coordinates for d1xiqf_.
(The format of our PDB-style files is described here.)

Timeline for d1xiqf_: