Lineage for d1xiqe_ (1xiq E:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603791Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 603792Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 603793Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)
  7. 603907Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117947] (1 PDB entry)
  8. 603912Domain d1xiqe_: 1xiq E: [115365]

Details for d1xiqe_

PDB Entry: 1xiq (more details), 3.05 Å

PDB Description: plasmodium falciparum nucleoside diphosphate kinase b

SCOP Domain Sequences for d1xiqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiqe_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7}
meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
asankeiniwfkaeeltqwkhhmkewics

SCOP Domain Coordinates for d1xiqe_:

Click to download the PDB-style file with coordinates for d1xiqe_.
(The format of our PDB-style files is described here.)

Timeline for d1xiqe_: