Lineage for d1xiqe_ (1xiq E:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117947] (1 PDB entry)
    Uniprot Q8ID43
  8. Domain d1xiqe_: 1xiq E: [115365]

Details for d1xiqe_

PDB Entry: 1xiq (more details), 3.05 Å

PDB Description: plasmodium falciparum nucleoside diphosphate kinase b
PDB Compounds: (E:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d1xiqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiqe_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}
meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
asankeiniwfkaeeltqwkhhmkewics

SCOPe Domain Coordinates for d1xiqe_ are not available.

Timeline for d1xiqe_:

Domains from other chains:
(mouse over for more information)
d1xiqa_, d1xiqb_, d1xiqc_, d1xiqd_, d1xiqf_