Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117947] (1 PDB entry) Uniprot Q8ID43 |
Domain d1xiqd_: 1xiq D: [115364] |
PDB Entry: 1xiq (more details), 3.05 Å
SCOPe Domain Sequences for d1xiqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xiqd_ d.58.6.1 (D:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv asankeiniwfkaeeltqwkhhmkewics
Timeline for d1xiqd_: