SCOP 1.71: Domain d1xiqc_: 1xiq C:

Lineage for d1xiqc_ (1xiq C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)

7. Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117947] (1 PDB entry)

8. Domain d1xiqc_: 1xiq C: [115363]

Details for d1xiqc_

PDB Entry: 1xiq, 3.05 Å

PDB Description: plasmodium falciparum nucleoside diphosphate kinase b

SCOP Domain Sequences for d1xiqc_:

Sequence; same for both SEQRES and ATOM records:

>d1xiqc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7}
meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
asankeiniwfkaeeltqwkhhmkewics

Timeline for d1xiqc_:

• d1xiqc_ is new in SCOP 1.71
  
• d1xiqc_ appears in SCOP 1.73
  
• d1xiqc_ appears in the current release, SCOPe 2.08