Lineage for d1xiqa_ (1xiq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951222Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117947] (1 PDB entry)
    Uniprot Q8ID43
  8. 2951223Domain d1xiqa_: 1xiq A: [115361]

Details for d1xiqa_

PDB Entry: 1xiq (more details), 3.05 Å

PDB Description: plasmodium falciparum nucleoside diphosphate kinase b
PDB Compounds: (A:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d1xiqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}
meksfimikpdgvqrglvgtiikrfekkgykliaikmlnpteeilkehykelsdqpffkn
lvayiskgpvvamvwegvdmvkqgrkligetnpltsntgtirgdfclevsknvihgsdsv
asankeiniwfkaeeltqwkhhmkewics

SCOPe Domain Coordinates for d1xiqa_:

Click to download the PDB-style file with coordinates for d1xiqa_.
(The format of our PDB-style files is described here.)

Timeline for d1xiqa_: