Lineage for d1xipa1 (1xip A:2-381)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066522Superfamily b.69.14: Nucleoporin domain [117289] (1 family) (S)
  5. 2066523Family b.69.14.1: Nucleoporin domain [117290] (2 protein domains)
  6. 2066527Protein Nucleoporin NUP159 [117293] (1 species)
  7. 2066528Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117294] (3 PDB entries)
    Uniprot P40477 2-381
  8. 2066529Domain d1xipa1: 1xip A:2-381 [115360]
    Other proteins in same PDB: d1xipa2

Details for d1xipa1

PDB Entry: 1xip (more details), 2.5 Å

PDB Description: Crystal Structure of the N-terminal Domain of Nup159
PDB Compounds: (A:) Nucleoporin NUP159

SCOPe Domain Sequences for d1xipa1:

Sequence, based on SEQRES records: (download)

>d1xipa1 b.69.14.1 (A:2-381) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgskavv
gelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefrtv
tsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllkdr
sfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetddev
sydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlasscs
sevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsgtilepcsgvdtier
lplvyilnnegslqivglfh

Sequence, based on observed residues (ATOM records): (download)

>d1xipa1 b.69.14.1 (A:2-381) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslkdevptetsedfgfkflgqkqilpsfneklpfaslqnldisnskslfvaasgskavv
gelqllrdhitsdstpltfkwekeipdvifvcfhgdqvlvstrnalysldleelsefrtv
tsfekpvfqlknvnntlvilnsvndlsaldlrtkstkqlaqnvtsfdvtnsqlavllkdr
sfqsfawrngemekqfefslpseleelpveeysplsvtilspqdflavfgnvisetddev
sydqkmyiikhidgsasfqetfditppfgqivrfpymykvtlsgliepdanvnvlasscs
sevsiwdskqviepsqdseravlpiseetdkdtnpigvavdvvtsglplvyilnnegslq
ivglfh

SCOPe Domain Coordinates for d1xipa1:

Click to download the PDB-style file with coordinates for d1xipa1.
(The format of our PDB-style files is described here.)

Timeline for d1xipa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xipa2