Lineage for d1xioa_ (1xio A:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619837Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 619838Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families) (S)
  5. 619839Family f.13.1.1: Bacteriorhodopsin-like [81319] (5 proteins)
  6. 619923Protein Sensory rhodopsin [118224] (1 species)
  7. 619924Species Anabaena sp. (strain PCC 7120) [TaxID: 103690] [118225] (1 PDB entry)
  8. 619925Domain d1xioa_: 1xio A: [115359]
    complexed with pee, ret

Details for d1xioa_

PDB Entry: 1xio (more details), 2 Å

PDB Description: anabaena sensory rhodopsin

SCOP Domain Sequences for d1xioa_:

Sequence, based on SEQRES records: (download)

>d1xioa_ f.13.1.1 (A:) Sensory rhodopsin {Anabaena sp. (strain PCC 7120) [TaxID: 103690]}
mnlesllhwiyvagmtigalhfwslsrnprgvpqyeylvamfipiwsglaymamaidqgk
veaagqiahyaryidwmvttpllllslswtamqfikkdwtligflmstqivvitsgliad
lserdwvrylwyicgvcafliilwgiwnplraktrtqsselanlydklvtyftvlwigyp
ivwiigpsgfgwinqtidtflfcllpffskvgfsfldlhglrnlnd

Sequence, based on observed residues (ATOM records): (download)

>d1xioa_ f.13.1.1 (A:) Sensory rhodopsin {Anabaena sp. (strain PCC 7120) [TaxID: 103690]}
mnlesllhwiyvagmtigalhfwslsrnprgvpqyeylvamfipiwsglaymamaidiah
yaryidwmvttpllllslswtamqfikkdwtligflmstqivvitsgliadlserdwvry
lwyicgvcafliilwgiwnplraktrtqsselanlydklvtyftvlwigypivwiigpsg
fgwinqtidtflfcllpffskvgfsfldlhglrnlnd

SCOP Domain Coordinates for d1xioa_:

Click to download the PDB-style file with coordinates for d1xioa_.
(The format of our PDB-style files is described here.)

Timeline for d1xioa_: