Lineage for d1xioa_ (1xio A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3022992Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 3023158Protein Sensory rhodopsin [118224] (1 species)
  7. 3023159Species Nostoc sp. PCC 7120 [TaxId:103690] [118225] (1 PDB entry)
    Uniprot Q8YSC4 # alr3165
  8. 3023160Domain d1xioa_: 1xio A: [115359]
    complexed with pee, ret

Details for d1xioa_

PDB Entry: 1xio (more details), 2 Å

PDB Description: anabaena sensory rhodopsin
PDB Compounds: (A:) anabaena sensory rhodopsin

SCOPe Domain Sequences for d1xioa_:

Sequence, based on SEQRES records: (download)

>d1xioa_ f.13.1.1 (A:) Sensory rhodopsin {Nostoc sp. PCC 7120 [TaxId: 103690]}
mnlesllhwiyvagmtigalhfwslsrnprgvpqyeylvamfipiwsglaymamaidqgk
veaagqiahyaryidwmvttpllllslswtamqfikkdwtligflmstqivvitsgliad
lserdwvrylwyicgvcafliilwgiwnplraktrtqsselanlydklvtyftvlwigyp
ivwiigpsgfgwinqtidtflfcllpffskvgfsfldlhglrnlnd

Sequence, based on observed residues (ATOM records): (download)

>d1xioa_ f.13.1.1 (A:) Sensory rhodopsin {Nostoc sp. PCC 7120 [TaxId: 103690]}
mnlesllhwiyvagmtigalhfwslsrnprgvpqyeylvamfipiwsglaymamaidiah
yaryidwmvttpllllslswtamqfikkdwtligflmstqivvitsgliadlserdwvry
lwyicgvcafliilwgiwnplraktrtqsselanlydklvtyftvlwigypivwiigpsg
fgwinqtidtflfcllpffskvgfsfldlhglrnlnd

SCOPe Domain Coordinates for d1xioa_:

Click to download the PDB-style file with coordinates for d1xioa_.
(The format of our PDB-style files is described here.)

Timeline for d1xioa_: