Lineage for d1xi9c_ (1xi9 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147073Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2147409Protein Putative alanine aminotransferase [117693] (1 species)
  7. 2147410Species Pyrococcus furiosus [TaxId:2261] [117694] (1 PDB entry)
    Uniprot Q9P9M8
  8. 2147413Domain d1xi9c_: 1xi9 C: [115357]
    Other proteins in same PDB: d1xi9a2
    Structural genomics target
    complexed with plp

Details for d1xi9c_

PDB Entry: 1xi9 (more details), 2.33 Å

PDB Description: alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
PDB Compounds: (C:) putative transaminase

SCOPe Domain Sequences for d1xi9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xi9c_ c.67.1.1 (C:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]}
raskralsveyairdvvlparelekkgikvirlnigdpvkfdfqppehmkeayckaikeg
hnyygdseglpelrkaiverekrkngvditpddvrvtaavtealqlifgalldpgdeilv
pgpsyppytglvkfyggkpveyrtieeedwqpdiddirkkitdrtkaiavinpnnptgal
ydkktleeilniageyeipvisdeiydlmtyegehispgsltkdvpvivmnglskvyfat
gwrlgymyfvdpenklsevreaidrlarirlcpntpaqfaaiagltgpmdylkeymkklk
errdyiykrlneipgisttkpqgafyifpkievgpwkndkefvldvlhnahvlfvhgsgf
geygaghfravflppieileeamdrfekfmker

SCOPe Domain Coordinates for d1xi9c_:

Click to download the PDB-style file with coordinates for d1xi9c_.
(The format of our PDB-style files is described here.)

Timeline for d1xi9c_: